PDB entry 1iap

View 1iap on RCSB PDB site
Description: crystal structure of p115rhogef rgrgs domain
Class: signaling protein
Keywords: p115, RhoGEF, RGS, RGRGS, signaling protein
Deposited on 2001-03-22, released 2001-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine nucleotide exchange factor p115rhogef
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1iapa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iapA (A:)
    qnsqfqsleqvkrrpahlmallqhvalqfepgpllcclhadmlgslgpkeakkafldfyh
    sflektavlrvpvppnvafeldrtradlisedvqrrfvqevvqsqqvavgrqledfrskr
    lmgmtpweqelaqleawvgrdrasyearerhvaerllmhleemqhtistdeeksaavvna
    iglymrhlgvrtksgdkksgrnffrkkvmgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iapA (A:)
    sqfqsleqvkrrpahlmallqhvalqfepgpllcclhadmlgslgpkeakkafldfyhsf
    lektavlrvpvppnvafeldrtradlisedvqrrfvqevvqsqqvavgrqledfrskrlm
    gmtpweqelaqleawvgrdrasyearerhvaerllmhleemqhtistdeeksaavvnaig
    lymrhlgvrt