SCOP 1.61: Domain d1i95m_: 1i95 M:

Lineage for d1i95m_ (1i95 M:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)

4. Superfamily a.5.5: Ribosomal protein S13 [46946] (1 family)

5. Family a.5.5.1: Ribosomal protein S13 [46947] (1 protein)

6. Protein Ribosomal protein S13 [46948] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46949] (10 PDB entries)

8. Domain d1i95m_: 1i95 M: [62026]
   Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_

Details for d1i95m_

PDB Entry: 1i95, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95m_:

Sequence; same for both SEQRES and ATOM records:

>d1i95m_ a.5.5.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrr

Timeline for d1i95m_:

• d1i95m_ first appeared in SCOP 1.57
  
• d1i95m_ appears in SCOP 1.59
  
• d1i95m_ appears in SCOP 1.63
  
• d1i95m_ appears in the current release, SCOPe 2.08