Lineage for d1i95j_ (1i95 J:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192588Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 192589Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 192590Protein Ribosomal protein S10 [55001] (1 species)
  7. 192591Species Thermus thermophilus [TaxId:274] [55002] (10 PDB entries)
  8. 192601Domain d1i95j_: 1i95 J: [62023]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_

Details for d1i95j_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95j_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1i95j_:

Click to download the PDB-style file with coordinates for d1i95j_.
(The format of our PDB-style files is described here.)

Timeline for d1i95j_: