Lineage for d1i95h_ (1i95 H:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196944Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
  4. 196945Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 196946Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 196947Protein Ribosomal protein S8 [56049] (3 species)
  7. 196954Species Thermus thermophilus [TaxId:274] [56051] (11 PDB entries)
  8. 196966Domain d1i95h_: 1i95 H: [62021]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_

Details for d1i95h_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95h_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestevpasrfkeeilkilaregfikgyervevdgkpylr
ihlkygprrqgpdprpeqvikhirrisrpgrrvyvgvkeiprvrrglgiailstpkgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1i95h_:

Click to download the PDB-style file with coordinates for d1i95h_.
(The format of our PDB-style files is described here.)

Timeline for d1i95h_: