Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.4: Translational machinery components [53137] (2 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein S11 [53141] (1 species) |
Species Thermus thermophilus [TaxId:274] [53142] (10 PDB entries) |
Domain d1i95k_: 1i95 K: [62024] Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_ |
PDB Entry: 1i95 (more details), 4.5 Å
SCOP Domain Sequences for d1i95k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i95k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus} kkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaal daakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr kas
Timeline for d1i95k_: