Lineage for d1i95r_ (1i95 R:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) 
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) 
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) Protein Ribosomal protein S18 [46913] (1 species) Species Thermus thermophilus [TaxId:274] [46914] (11 PDB entries) 
Domain d1i95r_: 1i95 R: [62031]
Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95s_, d1i95t_, d1i95u_
Details for d1i95r_
PDB Entry: 1i95 (more details), 4.5 Å
PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine
SCOP Domain Sequences for d1i95r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i95r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
kpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqril
aktikrarilgllpfteklvrk
SCOP Domain Coordinates for d1i95r_:
Click to download the PDB-style file with coordinates for d1i95r_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i95r_:
- d1i95r_ is new in SCOP 1.57
- d1i95r_ appears in SCOP 1.59
- d1i95r_ appears in the current release, SCOPe 2.08
View in 3D
