Lineage for d1i95b_ (1i95 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68672Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
  5. 68673Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 68674Protein Ribosomal protein S2 [52315] (1 species)
  7. 68675Species Thermus thermophilus [TaxId:274] [52316] (10 PDB entries)
  8. 68685Domain d1i95b_: 1i95 B: [62013]
    Other proteins in same PDB: d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_

Details for d1i95b_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95b_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus}
pveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedl
amrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleeleal
faspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklf
ipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe
aeatetpeg

SCOP Domain Coordinates for d1i95b_:

Click to download the PDB-style file with coordinates for d1i95b_.
(The format of our PDB-style files is described here.)

Timeline for d1i95b_: