Lineage for d1i95c1 (1i95 C:2-106)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79802Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)
  4. 79829Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family) (S)
  5. 79830Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins)
  6. 79835Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)
  7. 79836Species Thermus thermophilus [TaxId:274] [54817] (10 PDB entries)
  8. 79846Domain d1i95c1: 1i95 C:2-106 [62014]
    Other proteins in same PDB: d1i95b_, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_

Details for d1i95c1

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine
PDB Compounds: (C:)

SCOP Domain Sequences for d1i95c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1i95c1:

Click to download the PDB-style file with coordinates for d1i95c1.
(The format of our PDB-style files is described here.)

Timeline for d1i95c1: