SCOP 1.63: Domain d1i7qd_: 1i7q D:

Lineage for d1i7qd_ (1i7q D:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (5 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein Anthranilate synthase GAT subunit, TrpG [52323] (3 species)

7. Species Serratia marcescens [TaxId:615] [63970] (2 PDB entries)

8. Domain d1i7qd_: 1i7q D: [61904]
   Other proteins in same PDB: d1i7qa_, d1i7qc_
   complexed with bez, ilg, mg, pyr

Details for d1i7qd_

PDB Entry: 1i7q, 1.95 Å

PDB Description: anthranilate synthase from s. marcescens

SCOP Domain Sequences for d1i7qd_:

Sequence; same for both SEQRES and ATOM records:

>d1i7qd_ c.23.16.1 (D:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens}
adillldnvdsftynlvdqlrasghqvviyrnqigaeviierlqhmeqpvlmlspgpgtp
seagcmpellqrlrgqlpiigiclghqaiveayggqvgqageilhgkasaiahdgegmfa
gmanplpvaryhslvgsnipadltvnarfgemvmavrddrrrvcgfqfhpesiltthgar
lleqtlawalak

Timeline for d1i7qd_:

• d1i7qd_ first appeared in SCOP 1.57
  
• d1i7qd_ appears in SCOP 1.61
  
• d1i7qd_ appears in SCOP 1.65
  
• d1i7qd_ appears in the current release, SCOPe 2.08