| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) ![]() |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (5 proteins) |
| Protein Anthranilate synthase GAT subunit, TrpG [52323] (3 species) |
| Species Serratia marcescens [TaxId:615] [63970] (2 PDB entries) |
| Domain d1i7qd_: 1i7q D: [61904] Other proteins in same PDB: d1i7qa_, d1i7qc_ |
PDB Entry: 1i7q (more details), 1.95 Å
SCOP Domain Sequences for d1i7qd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7qd_ c.23.16.1 (D:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens}
adillldnvdsftynlvdqlrasghqvviyrnqigaeviierlqhmeqpvlmlspgpgtp
seagcmpellqrlrgqlpiigiclghqaiveayggqvgqageilhgkasaiahdgegmfa
gmanplpvaryhslvgsnipadltvnarfgemvmavrddrrrvcgfqfhpesiltthgar
lleqtlawalak
Timeline for d1i7qd_: