Lineage for d1i7qd_ (1i7q D:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) 
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (3 proteins) Protein Anthranilate synthase GAT subunit, TrpG [52323] (3 species) Species Serratia marcescens [TaxId:615] [63970] (2 PDB entries) 
Domain d1i7qd_: 1i7q D: [61904]
Other proteins in same PDB: d1i7qa_, d1i7qc_
Details for d1i7qd_
PDB Entry: 1i7q (more details), 1.95 Å
PDB Description: anthranilate synthase from s. marcescens
SCOP Domain Sequences for d1i7qd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7qd_ c.23.16.1 (D:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens}
adillldnvdsftynlvdqlrasghqvviyrnqigaeviierlqhmeqpvlmlspgpgtp
seagcmpellqrlrgqlpiigiclghqaiveayggqvgqageilhgkasaiahdgegmfa
gmanplpvaryhslvgsnipadltvnarfgemvmavrddrrrvcgfqfhpesiltthgar
lleqtlawalak
SCOP Domain Coordinates for d1i7qd_:
Click to download the PDB-style file with coordinates for d1i7qd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i7qd_:
- d1i7qd_ is new in SCOP 1.57
- d1i7qd_ appears in SCOP 1.59
- d1i7qd_ appears in the current release, SCOPe 2.08
View in 3D
