![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein) duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10 automatically mapped to Pfam PF03870 |
![]() | Protein RNA polymerase subunit RBP8 [50322] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries) Uniprot P20436 |
![]() | Domain d1i6hh_: 1i6h H: [61838] Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 1i6h (more details), 3.3 Å
SCOPe Domain Sequences for d1i6hh_:
Sequence, based on SEQRES records: (download)
>d1i6hh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl lmrlegnyrnlnnlkqenayllirr
>d1i6hh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln nlkqenayllirr
Timeline for d1i6hh_: