![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
![]() | Family d.74.3.2: RBP11/RpoL [64311] (4 proteins) |
![]() | Protein RPB11 [64312] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries) Uniprot P38902; part of multichain biological unit |
![]() | Domain d1i6hk_: 1i6h K: [61842] Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hl_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 1i6h (more details), 3.3 Å
SCOPe Domain Sequences for d1i6hk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6hk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d1i6hk_: