![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.1: Kringle modules [57441] (7 proteins) |
![]() | Protein Plasminogen [63400] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries) |
![]() | Domain d1i5kb1: 1i5k B:100-178 [61790] Other proteins in same PDB: d1i5kb2 kringle 2; complexed to an internal peptide from a group A streptococcal surface protein |
PDB Entry: 1i5k (more details), 2.7 Å
SCOPe Domain Sequences for d1i5kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5kb1 g.14.1.1 (B:100-178) Plasminogen {Human (Homo sapiens) [TaxId: 9606]} ecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlrp wcfttdpnkrweycdiprc
Timeline for d1i5kb1: