SCOP 1.57: Domain d1i5kb_: 1i5k B:

Lineage for d1i5kb_ (1i5k B:)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Plasminogen kringles [63400] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63401] (9 PDB entries)

8. Domain d1i5kb_: 1i5k B: [61790]

Details for d1i5kb_

PDB Entry: 1i5k, 2.7 Å

PDB Description: structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group a streptococcal surface protein

SCOP Domain Sequences for d1i5kb_:

Sequence; same for both SEQRES and ATOM records:

>d1i5kb_ g.14.1.1 (B:) Plasminogen kringles {Human (Homo sapiens)}
eecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlr
pwcfttdpnkrweycdiprc

Timeline for d1i5kb_:

• d1i5kb_ is new in SCOP 1.57
  
• d1i5kb_ appears in SCOP 1.59
  
• d1i5kb_ appears in the current release, SCOPe 2.08, called d1i5kb1