SCOPe 2.07: Domain d1i5kb1: 1i5k B:100-178

Lineage for d1i5kb1 (1i5k B:100-178)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Plasminogen [63400] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)

8. Domain d1i5kb1: 1i5k B:100-178 [61790]
   Other proteins in same PDB: d1i5kb2
   kringle 2; complexed to an internal peptide from a group A streptococcal surface protein

Details for d1i5kb1

PDB Entry: 1i5k, 2.7 Å

PDB Description: structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group a streptococcal surface protein

PDB Compounds: (B:) plasminogen

SCOPe Domain Sequences for d1i5kb1:

Sequence; same for both SEQRES and ATOM records:

>d1i5kb1 g.14.1.1 (B:100-178) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
ecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrdlrp
wcfttdpnkrweycdiprc

Timeline for d1i5kb1:

• d1i5kb1 first appeared in SCOP 1.57, called d1i5kb_
  
• d1i5kb1 appears in SCOPe 2.06
  
• d1i5kb1 appears in the current release, SCOPe 2.08