| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) ![]() form homo and heterodimers |
| Family d.74.3.2: RBP11/RpoL [64311] (3 proteins) |
| Protein RPB11 [64312] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries) Uniprot P38902; part of multichain biological unit |
| Domain d1i50k_: 1i50 K: [61765] Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50j_, d1i50l_ protein/RNA complex; complexed with mn, zn |
PDB Entry: 1i50 (more details), 2.8 Å
SCOPe Domain Sequences for d1i50k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i50k_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d1i50k_: