Lineage for d1i50c2 (1i50 C:42-172)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049688Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1049689Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 1049690Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1049743Protein RPB3 [64462] (1 species)
  7. 1049744Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 1049746Domain d1i50c2: 1i50 C:42-172 [61757]
    Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50e1, d1i50e2, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50j_, d1i50k_, d1i50l_
    protein/RNA complex; complexed with mn, zn

Details for d1i50c2

PDB Entry: 1i50 (more details), 2.8 Å

PDB Description: rna polymerase ii crystal form ii at 2.8 a resolution
PDB Compounds: (C:) DNA-directed RNA polymerase II 45kd polypeptide

SCOPe Domain Sequences for d1i50c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i50c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOPe Domain Coordinates for d1i50c2:

Click to download the PDB-style file with coordinates for d1i50c2.
(The format of our PDB-style files is described here.)

Timeline for d1i50c2: