Lineage for d1i50k_ (1i50 K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958258Family d.74.3.2: RBP11/RpoL [64311] (4 proteins)
  6. 2958268Protein RPB11 [64312] (2 species)
  7. 2958269Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 2958275Domain d1i50k_: 1i50 K: [61765]
    Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50j_, d1i50l_
    protein/RNA complex; complexed with mn, zn

Details for d1i50k_

PDB Entry: 1i50 (more details), 2.8 Å

PDB Description: rna polymerase ii crystal form ii at 2.8 a resolution
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6kd polypeptide

SCOPe Domain Sequences for d1i50k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i50k_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d1i50k_:

Click to download the PDB-style file with coordinates for d1i50k_.
(The format of our PDB-style files is described here.)

Timeline for d1i50k_: