Lineage for d1i4zb_ (1i4z B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313254Superfamily a.24.4: Hemerythrin-like [47188] (1 family) (S)
  5. 2313255Family a.24.4.1: Hemerythrin-like [47189] (2 proteins)
    Iron-binding proteins
  6. 2313256Protein Hemerythrin [47190] (2 species)
  7. 2313257Species Phascolopsis gouldii [TaxId:6442] [47192] (3 PDB entries)
  8. 2313267Domain d1i4zb_: 1i4z B: [61747]
    complexed with feo

Details for d1i4zb_

PDB Entry: 1i4z (more details), 2.1 Å

PDB Description: the crystal structure of phascolopsis gouldii l98y methemerythrin
PDB Compounds: (B:) methemerythrin

SCOPe Domain Sequences for d1i4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4zb_ a.24.4.1 (B:) Hemerythrin {Phascolopsis gouldii [TaxId: 6442]}
gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
lmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki

SCOPe Domain Coordinates for d1i4zb_:

Click to download the PDB-style file with coordinates for d1i4zb_.
(The format of our PDB-style files is described here.)

Timeline for d1i4zb_: