Lineage for d1i4zb_ (1i4z B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46463Fold a.24: Four-helical up-and-down bundle [47161] (12 superfamilies)
  4. 46537Superfamily a.24.4: Hemerythrin [47188] (1 family) (S)
  5. 46538Family a.24.4.1: Hemerythrin [47189] (2 proteins)
  6. 46539Protein Hemerythrin [47190] (2 species)
  7. 46540Species Phascolopsis gouldii [TaxId:6442] [47192] (3 PDB entries)
  8. 46550Domain d1i4zb_: 1i4z B: [61747]

Details for d1i4zb_

PDB Entry: 1i4z (more details), 2.1 Å

PDB Description: the crystal structure of phascolopsis gouldii l98y methemerythrin

SCOP Domain Sequences for d1i4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4zb_ a.24.4.1 (B:) Hemerythrin {Phascolopsis gouldii}
gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
lmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki

SCOP Domain Coordinates for d1i4zb_:

Click to download the PDB-style file with coordinates for d1i4zb_.
(The format of our PDB-style files is described here.)

Timeline for d1i4zb_: