Lineage for d1i3rh1 (1i3r H:121-216)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548888Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 548954Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 548964Domain d1i3rh1: 1i3r H:121-216 [61634]
    Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb2, d1i3rc1, d1i3rc2, d1i3rd2, d1i3re1, d1i3re2, d1i3rf2, d1i3rg1, d1i3rg2, d1i3rh2
    contains covalently bound peptides at the N-termini of chains B, D, F and H
    complexed with nag; mutant

Details for d1i3rh1

PDB Entry: 1i3r (more details), 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule

SCOP Domain Sequences for d1i3rh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3rh1 b.1.1.2 (H:121-216) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group}
veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
fqtlvmletvpqsgevytcqvehpsltdpvtvewka

SCOP Domain Coordinates for d1i3rh1:

Click to download the PDB-style file with coordinates for d1i3rh1.
(The format of our PDB-style files is described here.)

Timeline for d1i3rh1: