| Class b: All beta proteins [48724] (149 folds) | 
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands  | 
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]()  | 
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) | 
| Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) | 
| Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries) probably orthologous to the human HLA-DR group  | 
| Domain d1i3rd1: 1i3r D:121-216 [61626] Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb2, d1i3rc1, d1i3rc2, d1i3rd2, d1i3re1, d1i3re2, d1i3rf2, d1i3rg1, d1i3rg2, d1i3rh2  | 
PDB Entry: 1i3r (more details), 2.4 Å
SCOP Domain Sequences for d1i3rd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3rd1 b.1.1.2 (D:121-216) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group}
veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
fqtlvmletvpqsgevytcqvehpsltdpvtvewka
Timeline for d1i3rd1: