Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries) probably orthologous to the human HLA-DR group |
Domain d1i3rh1: 1i3r H:121-216 [61634] Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb2, d1i3rc1, d1i3rc2, d1i3rd2, d1i3re1, d1i3re2, d1i3rf2, d1i3rg1, d1i3rg2, d1i3rh2 contains covalently bound peptides at the N-termini of chains B, D, F and H complexed with nag; mutant |
PDB Entry: 1i3r (more details), 2.4 Å
SCOPe Domain Sequences for d1i3rh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3rh1 b.1.1.2 (H:121-216) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt fqtlvmletvpqsgevytcqvehpsltdpvtvewka
Timeline for d1i3rh1: