Lineage for d1i3rh1 (1i3r H:121-216)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53149Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species)
  7. 53223Species Mouse (Mus musculus), I-EK [TaxId:10090] [49139] (5 PDB entries)
  8. 53243Domain d1i3rh1: 1i3r H:121-216 [61634]
    Other proteins in same PDB: d1i3ra2, d1i3rb2, d1i3rc2, d1i3rd2, d1i3re2, d1i3rf2, d1i3rg2, d1i3rh2

Details for d1i3rh1

PDB Entry: 1i3r (more details), 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule

SCOP Domain Sequences for d1i3rh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3rh1 b.1.1.2 (H:121-216) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
fqtlvmletvpqsgevytcqvehpsltdpvtvewka

SCOP Domain Coordinates for d1i3rh1:

Click to download the PDB-style file with coordinates for d1i3rh1.
(The format of our PDB-style files is described here.)

Timeline for d1i3rh1: