Class g: Small proteins [56992] (79 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (6 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64540] (6 PDB entries) |
Domain d1i0ua1: 1i0u A:1-41 [61493] |
PDB Entry: 1i0u (more details)
SCOP Domain Sequences for d1i0ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0ua1 g.3.11.1 (A:1-41) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens)} gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrced
Timeline for d1i0ua1: