PDB entry 1i0u

View 1i0u on RCSB PDB site
Description: solution structure and backbone dynamics of a concatemer of egf- homology modules of the human low density lipoprotein receptor
Deposited on 2001-01-29, released 2001-08-15
The last revision prior to the SCOP 1.71 freeze date was dated 2001-08-15, with a file datestamp of 2001-08-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i0uA (A:)
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtcsqlcvnleg
gykcqceegfqldphtkackav