![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) [48462] (2 species) |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [63617] (6 PDB entries) |
![]() | Domain d1hxia_: 1hxi A: [61366] complexed with mg applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1hxi (more details), 1.6 Å
SCOPe Domain Sequences for d1hxia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} nntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqkepereeawrslgltq aenekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawll
Timeline for d1hxia_: