Lineage for d1hxia_ (1hxi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726750Protein Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) [48462] (2 species)
  7. 2726754Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [63617] (6 PDB entries)
  8. 2726755Domain d1hxia_: 1hxi A: [61366]
    complexed with mg
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1hxia_

PDB Entry: 1hxi (more details), 1.6 Å

PDB Description: an unexpected extended conformation for the third tpr motif of the peroxin pex5 from trypanosoma brucei
PDB Compounds: (A:) Peroxisome targeting signal 1 receptor PEX5

SCOPe Domain Sequences for d1hxia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
nntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqkepereeawrslgltq
aenekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawll

SCOPe Domain Coordinates for d1hxia_:

Click to download the PDB-style file with coordinates for d1hxia_.
(The format of our PDB-style files is described here.)

Timeline for d1hxia_: