SCOP 1.57: Domain d1hxia_: 1hxi A:

Lineage for d1hxia_ (1hxi A:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)

4. Superfamily a.118.8: Tetratricopeptide repeat (TPR) [48452] (1 family)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (6 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) [48462] (2 species)

7. Species Trypanosoma brucei [TaxId:5691] [63617] (1 PDB entry)

8. Domain d1hxia_: 1hxi A: [61366]

Details for d1hxia_

PDB Entry: 1hxi, 1.6 Å

PDB Description: an unexpected extended conformation for the third tpr motif of the peroxin pex5 from trypanosoma brucei

SCOP Domain Sequences for d1hxia_:

Sequence; same for both SEQRES and ATOM records:

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei}
nntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqkepereeawrslgltq
aenekdglaiialnharmldpkdiavhaalavshtnehnanaalaslrawll

Timeline for d1hxia_:

• d1hxia_ is new in SCOP 1.57
  
• d1hxia_ appears in SCOP 1.59
  
• d1hxia_ appears in the current release, SCOPe 2.08