Lineage for d1hc7c1 (1hc7 C:277-403)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181602Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 181603Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 181604Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 181605Protein C-terminal domain of ProRS [64071] (1 species)
  7. 181606Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries)
  8. 181609Domain d1hc7c1: 1hc7 C:277-403 [60944]
    Other proteins in same PDB: d1hc7a2, d1hc7a3, d1hc7b2, d1hc7b3, d1hc7c2, d1hc7c3, d1hc7d2, d1hc7d3

Details for d1hc7c1

PDB Entry: 1hc7 (more details), 2.43 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1hc7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hc7c1 c.51.1.1 (C:277-403) C-terminal domain of ProRS {Thermus thermophilus}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh

SCOP Domain Coordinates for d1hc7c1:

Click to download the PDB-style file with coordinates for d1hc7c1.
(The format of our PDB-style files is described here.)

Timeline for d1hc7c1: