SCOP 1.59: Domain d1hc7c1: 1hc7 C:277-403

Lineage for d1hc7c1 (1hc7 C:277-403)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein C-terminal domain of ProRS [64071] (1 species)

7. Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries)

8. Domain d1hc7c1: 1hc7 C:277-403 [60944]
   Other proteins in same PDB: d1hc7a2, d1hc7a3, d1hc7b2, d1hc7b3, d1hc7c2, d1hc7c3, d1hc7d2, d1hc7d3

Details for d1hc7c1

PDB Entry: 1hc7, 2.43 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1hc7c1:

Sequence; same for both SEQRES and ATOM records:

>d1hc7c1 c.51.1.1 (C:277-403) C-terminal domain of ProRS {Thermus thermophilus}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh

Timeline for d1hc7c1:

• d1hc7c1 first appeared in SCOP 1.57
  
• d1hc7c1 appears in SCOP 1.61
  
• d1hc7c1 appears in the current release, SCOPe 2.08