Lineage for d1hc7a3 (1hc7 A:404-477)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 205354Fold g.56: C-terminal domain of ProRS [64585] (1 superfamily)
  4. 205355Superfamily g.56.1: C-terminal domain of ProRS [64586] (1 family) (S)
  5. 205356Family g.56.1.1: C-terminal domain of ProRS [64587] (1 protein)
  6. 205357Protein C-terminal domain of ProRS [64588] (1 species)
  7. 205358Species Thermus thermophilus [TaxId:274] [64589] (4 PDB entries)
  8. 205359Domain d1hc7a3: 1hc7 A:404-477 [60940]
    Other proteins in same PDB: d1hc7a1, d1hc7a2, d1hc7b1, d1hc7b2, d1hc7c1, d1hc7c2, d1hc7d1, d1hc7d2

Details for d1hc7a3

PDB Entry: 1hc7 (more details), 2.43 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1hc7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hc7a3 g.56.1.1 (A:404-477) C-terminal domain of ProRS {Thermus thermophilus}
trkvdtyeafkeavqegfalafhcgdkacerliqeettattrcvpfeaepeegfcvrcgr
psaygkrvvfakay

SCOP Domain Coordinates for d1hc7a3:

Click to download the PDB-style file with coordinates for d1hc7a3.
(The format of our PDB-style files is described here.)

Timeline for d1hc7a3: