Lineage for d1hbuf_ (1hbu F:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 258057Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 258058Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 258059Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 258060Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (5 PDB entries)
  8. 258070Domain d1hbuf_: 1hbu F: [60927]
    Other proteins in same PDB: d1hbua1, d1hbua2, d1hbub1, d1hbub2, d1hbud1, d1hbud2, d1hbue1, d1hbue2
    complexed with cl, com, f43, gol, mg, mgn, na, tp7, zn

Details for d1hbuf_

PDB Entry: 1hbu (more details), 1.9 Å

PDB Description: methyl-coenzyme m reductase in the mcr-red1-silent state in complex with coenzyme m

SCOP Domain Sequences for d1hbuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbuf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanobacterium thermoautotrophicum}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOP Domain Coordinates for d1hbuf_:

Click to download the PDB-style file with coordinates for d1hbuf_.
(The format of our PDB-style files is described here.)

Timeline for d1hbuf_: