| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
| Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (15 PDB entries) |
| Domain d1hbuf_: 1hbu F: [60927] Other proteins in same PDB: d1hbua1, d1hbua2, d1hbub1, d1hbub2, d1hbud1, d1hbud2, d1hbue1, d1hbue2 complexed with cl, com, f43, gol, mg, na, tp7, zn |
PDB Entry: 1hbu (more details), 1.9 Å
SCOPe Domain Sequences for d1hbuf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbuf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl
Timeline for d1hbuf_: