Lineage for d1hbud1 (1hbu D:270-549)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002224Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2002225Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2002226Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 protein domains)
    C-terminal domain is all-alpha
  6. 2002227Protein Alpha chain [48083] (3 species)
  7. 2002228Species Methanobacterium thermoautotrophicum [TaxId:145262] [48084] (11 PDB entries)
  8. 2002250Domain d1hbud1: 1hbu D:270-549 [60923]
    Other proteins in same PDB: d1hbua2, d1hbub1, d1hbub2, d1hbuc_, d1hbud2, d1hbue1, d1hbue2, d1hbuf_
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbud1

PDB Entry: 1hbu (more details), 1.9 Å

PDB Description: methyl-coenzyme m reductase in the mcr-red1-silent state in complex with coenzyme m
PDB Compounds: (D:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1hbud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbud1 a.89.1.1 (D:270-549) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

SCOPe Domain Coordinates for d1hbud1:

Click to download the PDB-style file with coordinates for d1hbud1.
(The format of our PDB-style files is described here.)

Timeline for d1hbud1: