SCOP 1.57: Domain d1hbne2: 1hbn E:2-188

Lineage for d1hbne2 (1hbn E:2-188)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families)

5. Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)

6. Protein Beta chain [55099] (3 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (5 PDB entries)

8. Domain d1hbne2: 1hbn E:2-188 [60906]
   Other proteins in same PDB: d1hbna1, d1hbna2, d1hbnb1, d1hbnc_, d1hbnd1, d1hbnd2, d1hbne1, d1hbnf_

Details for d1hbne2

PDB Entry: 1hbn, 1.16 Å

PDB Description: methyl-coenzyme m reductase

SCOP Domain Sequences for d1hbne2:

Sequence; same for both SEQRES and ATOM records:

>d1hbne2 d.58.31.2 (E:2-188) Beta chain {Archaeon Methanobacterium thermoautotrophicum}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

Timeline for d1hbne2:

• d1hbne2 is new in SCOP 1.57
  
• d1hbne2 appears in SCOP 1.59
  
• d1hbne2 appears in the current release, SCOPe 2.08