SCOP 1.57: Domain d1hbna2: 1hbn A:2-269

Lineage for d1hbna2 (1hbn A:2-269)

Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families)
Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
Protein Alpha chain [55095] (3 species)
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (5 PDB entries)
Domain d1hbna2: 1hbn A:2-269 [60899]
Other proteins in same PDB: d1hbna1, d1hbnb1, d1hbnb2, d1hbnc_, d1hbnd1, d1hbne1, d1hbne2, d1hbnf_

Details for d1hbna2

PDB Entry: 1hbn (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase

SCOP Domain Sequences for d1hbna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbna2 d.58.31.2 (A:2-269) Alpha chain {Archaeon Methanobacterium thermoautotrophicum}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOP Domain Coordinates for d1hbna2:

Click to download the PDB-style file with coordinates for d1hbna2.
(The format of our PDB-style files is described here.)

Timeline for d1hbna2: