Lineage for d1hbnc_ (1hbn C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80803Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
  5. 80804Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 80805Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 80806Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (5 PDB entries)
  8. 80807Domain d1hbnc_: 1hbn C: [60902]
    Other proteins in same PDB: d1hbna1, d1hbna2, d1hbnb1, d1hbnb2, d1hbnd1, d1hbnd2, d1hbne1, d1hbne2

Details for d1hbnc_

PDB Entry: 1hbn (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase

SCOP Domain Sequences for d1hbnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbnc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanobacterium thermoautotrophicum}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOP Domain Coordinates for d1hbnc_:

Click to download the PDB-style file with coordinates for d1hbnc_.
(The format of our PDB-style files is described here.)

Timeline for d1hbnc_: