SCOPe 2.08: Domain d1hbne2: 1hbn E:2-188

Lineage for d1hbne2 (1hbn E:2-188)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Beta chain [55099] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries)

8. Domain d1hbne2: 1hbn E:2-188 [60906]
   Other proteins in same PDB: d1hbna1, d1hbna2, d1hbnb1, d1hbnc_, d1hbnd1, d1hbnd2, d1hbne1, d1hbnf_
   complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbne2

PDB Entry: 1hbn, 1.16 Å

PDB Description: methyl-coenzyme m reductase

PDB Compounds: (E:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1hbne2:

Sequence; same for both SEQRES and ATOM records:

>d1hbne2 d.58.31.2 (E:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

Timeline for d1hbne2:

• d1hbne2 first appeared in SCOP 1.57
  
• d1hbne2 appears in SCOPe 2.07