Lineage for d1hbnc_ (1hbn C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561884Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2561885Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
    automatically mapped to Pfam PF02240
  6. 2561886Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 2561887Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (14 PDB entries)
  8. 2561890Domain d1hbnc_: 1hbn C: [60902]
    Other proteins in same PDB: d1hbna1, d1hbna2, d1hbnb1, d1hbnb2, d1hbnd1, d1hbnd2, d1hbne1, d1hbne2
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbnc_

PDB Entry: 1hbn (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase
PDB Compounds: (C:) methyl-coenzyme m reductase I gamma subunit

SCOPe Domain Sequences for d1hbnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbnc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOPe Domain Coordinates for d1hbnc_:

Click to download the PDB-style file with coordinates for d1hbnc_.
(The format of our PDB-style files is described here.)

Timeline for d1hbnc_: