Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (14 PDB entries) |
Domain d1hbnc_: 1hbn C: [60902] Other proteins in same PDB: d1hbna1, d1hbna2, d1hbnb1, d1hbnb2, d1hbnd1, d1hbnd2, d1hbne1, d1hbne2 complexed with cl, com, f43, gol, mg, na, tp7, zn |
PDB Entry: 1hbn (more details), 1.16 Å
SCOPe Domain Sequences for d1hbnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbnc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]} aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr sqggfnl
Timeline for d1hbnc_: