Lineage for d1hbne1 (1hbn E:189-443)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332765Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2332766Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2332767Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2332798Protein Beta chain [48087] (3 species)
  7. 2332799Species Methanobacterium thermoautotrophicum [TaxId:145262] [48088] (11 PDB entries)
  8. 2332801Domain d1hbne1: 1hbn E:189-443 [60905]
    Other proteins in same PDB: d1hbna1, d1hbna2, d1hbnb2, d1hbnc_, d1hbnd1, d1hbnd2, d1hbne2, d1hbnf_
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbne1

PDB Entry: 1hbn (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase
PDB Compounds: (E:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1hbne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbne1 a.89.1.1 (E:189-443) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOPe Domain Coordinates for d1hbne1:

Click to download the PDB-style file with coordinates for d1hbne1.
(The format of our PDB-style files is described here.)

Timeline for d1hbne1: