| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.58: Ferredoxin-like [54861] (40 superfamilies) |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) ![]() |
| Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins) |
| Protein Beta chain [55099] (3 species) |
| Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (5 PDB entries) |
| Domain d1hbmb2: 1hbm B:2-188 [60891] Other proteins in same PDB: d1hbma1, d1hbma2, d1hbmb1, d1hbmc_, d1hbmd1, d1hbmd2, d1hbme1, d1hbmf_ |
PDB Entry: 1hbm (more details), 1.8 Å
SCOP Domain Sequences for d1hbmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbmb2 d.58.31.2 (B:2-188) Beta chain {Archaeon Methanobacterium thermoautotrophicum}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp
Timeline for d1hbmb2: