Lineage for d1hbmc_ (1hbm C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192859Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
  5. 192860Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 192861Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 192862Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (5 PDB entries)
  8. 192867Domain d1hbmc_: 1hbm C: [60892]
    Other proteins in same PDB: d1hbma1, d1hbma2, d1hbmb1, d1hbmb2, d1hbmd1, d1hbmd2, d1hbme1, d1hbme2

Details for d1hbmc_

PDB Entry: 1hbm (more details), 1.8 Å

PDB Description: methyl-coenzyme m reductase enzyme product complex

SCOP Domain Sequences for d1hbmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbmc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanobacterium thermoautotrophicum}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOP Domain Coordinates for d1hbmc_:

Click to download the PDB-style file with coordinates for d1hbmc_.
(The format of our PDB-style files is described here.)

Timeline for d1hbmc_: