Lineage for d1hbmb2 (1hbm B:2-188)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 134153Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
  5. 134173Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
  6. 134192Protein Beta chain [55099] (3 species)
  7. 134193Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (5 PDB entries)
  8. 134198Domain d1hbmb2: 1hbm B:2-188 [60891]
    Other proteins in same PDB: d1hbma1, d1hbma2, d1hbmb1, d1hbmc_, d1hbmd1, d1hbmd2, d1hbme1, d1hbmf_

Details for d1hbmb2

PDB Entry: 1hbm (more details), 1.8 Å

PDB Description: methyl-coenzyme m reductase enzyme product complex

SCOP Domain Sequences for d1hbmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbmb2 d.58.31.2 (B:2-188) Beta chain {Archaeon Methanobacterium thermoautotrophicum}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

SCOP Domain Coordinates for d1hbmb2:

Click to download the PDB-style file with coordinates for d1hbmb2.
(The format of our PDB-style files is described here.)

Timeline for d1hbmb2: