Lineage for d1hbma2 (1hbm A:2-269)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 134153Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
  5. 134173Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
  6. 134174Protein Alpha chain [55095] (3 species)
  7. 134175Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (5 PDB entries)
  8. 134180Domain d1hbma2: 1hbm A:2-269 [60889]
    Other proteins in same PDB: d1hbma1, d1hbmb1, d1hbmb2, d1hbmc_, d1hbmd1, d1hbme1, d1hbme2, d1hbmf_

Details for d1hbma2

PDB Entry: 1hbm (more details), 1.8 Å

PDB Description: methyl-coenzyme m reductase enzyme product complex

SCOP Domain Sequences for d1hbma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbma2 d.58.31.2 (A:2-269) Alpha chain {Archaeon Methanobacterium thermoautotrophicum}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOP Domain Coordinates for d1hbma2:

Click to download the PDB-style file with coordinates for d1hbma2.
(The format of our PDB-style files is described here.)

Timeline for d1hbma2: