SCOPe 2.07: Domain d1h9tb1: 1h9t B:5-78

Lineage for d1h9tb1 (1h9t B:5-78)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.6: GntR-like transcriptional regulators [46804] (4 proteins)

6. Protein Fatty acid responsive transcription factor FadR, N-terminal domain [46805] (1 species)

7. Species Escherichia coli [TaxId:562] [46806] (5 PDB entries)

8. Domain d1h9tb1: 1h9t B:5-78 [60849]
   Other proteins in same PDB: d1h9ta2, d1h9tb2
   complex with fadB operator
   complexed with au, cl

Details for d1h9tb1

PDB Entry: 1h9t, 3.25 Å

PDB Description: fadr, fatty acid responsive transcription factor from e. coli in complex with fadb operator

PDB Compounds: (B:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d1h9tb1:

Sequence; same for both SEQRES and ATOM records:

>d1h9tb1 a.4.5.6 (B:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]}
aqspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiq
hgkptkvnnfwets

Timeline for d1h9tb1:

• d1h9tb1 first appeared in SCOP 1.57
  
• d1h9tb1 appears in SCOPe 2.06
  
• d1h9tb1 appears in the current release, SCOPe 2.08