![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.6: GntR-like transcriptional regulators [46804] (4 proteins) |
![]() | Protein Fatty acid responsive transcription factor FadR, N-terminal domain [46805] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46806] (5 PDB entries) |
![]() | Domain d1h9tb1: 1h9t B:5-78 [60849] Other proteins in same PDB: d1h9ta2, d1h9tb2 complex with fadB operator complexed with au, cl |
PDB Entry: 1h9t (more details), 3.25 Å
SCOPe Domain Sequences for d1h9tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h9tb1 a.4.5.6 (B:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} aqspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiq hgkptkvnnfwets
Timeline for d1h9tb1: