Lineage for d1h9tb1 (1h9t B:5-78)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45500Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) (S)
  5. 45551Family a.4.5.6: GntR-like transcriptional regulators [46804] (1 protein)
  6. 45552Protein Fatty acid responsive transcription factor FadR, N-terminal domain [46805] (1 species)
  7. 45553Species Escherichia coli [TaxId:562] [46806] (5 PDB entries)
  8. 45561Domain d1h9tb1: 1h9t B:5-78 [60849]
    Other proteins in same PDB: d1h9ta2, d1h9tb2

Details for d1h9tb1

PDB Entry: 1h9t (more details), 3.25 Å

PDB Description: fadr, fatty acid responsive transcription factor from e. coli in complex with fadb operator

SCOP Domain Sequences for d1h9tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9tb1 a.4.5.6 (B:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli}
aqspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiq
hgkptkvnnfwets

SCOP Domain Coordinates for d1h9tb1:

Click to download the PDB-style file with coordinates for d1h9tb1.
(The format of our PDB-style files is described here.)

Timeline for d1h9tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9tb2