SCOPe 2.06: Domain d1h91b_: 1h91 B:

Lineage for d1h91b_ (1h91 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Alpha-crustacyanin [63807] (1 species)

7. Species European lobster (Homarus gammarus) [TaxId:6707] [63808] (7 PDB entries)

8. Domain d1h91b_: 1h91 B: [60806]
   A1 subunit
   complexed with mpd

Details for d1h91b_

PDB Entry: 1h91, 1.4 Å

PDB Description: the crystal structure of lobster apocrustacyanin a1 using softer x- rays.

PDB Compounds: (B:) crustacyanin a1 subunit

SCOPe Domain Sequences for d1h91b_:

Sequence; same for both SEQRES and ATOM records:

>d1h91b_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}
kipnfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk
qfvikstgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc
idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktv

Timeline for d1h91b_:

• d1h91b_ first appeared in SCOP 1.57
  
• d1h91b_ appears in SCOPe 2.05
  
• d1h91b_ appears in SCOPe 2.07
  
• d1h91b_ appears in the current release, SCOPe 2.08