Lineage for d1h91b_ (1h91 B:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.1: Retinol binding protein-like [50815] (14 proteins) Protein Alpha-crustacyanin [63807] (1 species) Species European lobster (Homarus gammarus) [TaxId:6707] [63808] (2 PDB entries) 
Domain d1h91b_: 1h91 B: [60806]
Details for d1h91b_
PDB Entry: 1h91 (more details), 1.4 Å
PDB Description: the crystal structure of lobster apocrustacyanin a1 using softer x- rays.
SCOP Domain Sequences for d1h91b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h91b_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus)}
kipnfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk
qfvikstgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc
idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktv
SCOP Domain Coordinates for d1h91b_:
Click to download the PDB-style file with coordinates for d1h91b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h91b_:
- d1h91b_ is new in SCOP 1.57
- d1h91b_ appears in SCOP 1.59
- d1h91b_ appears in the current release, SCOPe 2.08
View in 3D
